PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G150100.1
Common NamePHAVU_005G150100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family EIL
Protein Properties Length: 593aa    MW: 66532.6 Da    PI: 6.3903
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G150100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3433.22.5e-132383551303
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         eel++rmwkd+++lkrlker+k  +  ++ a++++k ++s++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd++
  Phvul.005G150100.1  38 EELERRMWKDRIKLKRLKERQKLAI--QQ-AAEKQKPRQSSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDNI 125
                         8*********************877..44.489********************************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         raWWkekv+fd+ngpaai+ky+a++l++s+++++  ++ ++++ l++lqD+tlgSLLs+lmqhcdppqr++plekgv+pPWWPtG+e+ww+
  Phvul.005G150100.1 126 RAWWKEKVKFDKNGPAAIAKYEAECLAMSEADNS--RNGNSQSILQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGVPPPWWPTGNEDWWS 214
                         *****************************99988..78999999*********************************************** PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX........ CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss........ 265
                         +l l++ q+ ppykkphdlkk+wkv+vLtavikhmsp+i++ir+++rqsk+lqdkm+akes+++l+vl++ee+++++ s+++         
  Phvul.005G150100.1 215 QLNLPHGQS-PPYKKPHDLKKMWKVGVLTAVIKHMSPNIAKIRRHVRQSKCLQDKMTAKESAIWLAVLSREEALIRQPSSDNGtsgitgml 304
                         ********9.9**********************************************************************5445677765 PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX.............X CS
                EIN3 266 slrkqspkvtlsceqkedvegkkeskikhvqavktta.............g 303
                              ++k  +s+ +++dv+g+++   + +++ +++               
  Phvul.005G150100.1 305 PGVPAENKQAASSASNYDVDGTDDGIGSVSSKADRRIqsmdtepsdnlhrV 355
                         4444888889999999****6666554443333332223333334444431 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.1E-12738285No hitNo description
Gene3DG3DSA:1.10.3180.109.7E-72160293IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167686.93E-62166289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MADMEEIGPD VCSDLEVDDI RCPNIAEKDV SDEEIEAEEL ERRMWKDRIK LKRLKERQKL  60
AIQQAAEKQK PRQSSDQARR KKMSRAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
SSDNIRAWWK EKVKFDKNGP AAIAKYEAEC LAMSEADNSR NGNSQSILQD LQDATLGSLL  180
SSLMQHCDPP QRKYPLEKGV PPPWWPTGNE DWWSQLNLPH GQSPPYKKPH DLKKMWKVGV  240
LTAVIKHMSP NIAKIRRHVR QSKCLQDKMT AKESAIWLAV LSREEALIRQ PSSDNGTSGI  300
TGMLPGVPAE NKQAASSASN YDVDGTDDGI GSVSSKADRR IQSMDTEPSD NLHRVTKSVQ  360
DKDQPKRPRP KKPRLNSRAV DKPPAQSDNE ILHVEPRGKG LNINQTEAQA VRIQIHGNEQ  420
SNETDSAARP LEKELEVPTQ LLAPEFDHYS YLHTNNLISS ESIYTSGRPI QYPELQNPDM  480
HHETTYNLYN PAAGHEPGHY RQQLHPGNSS EARPDIDAVH AQAVHMKGDE ITGGDLQYFG  540
KDAFQNELDR PIDHSFFGSP LSSMSLDFGG LNSPFHLDDF LGDDEMIQYF GA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A1e-741652969140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1365369KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150399.10.0hypothetical protein PHAVU_005G150100g
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLV7BZ650.0V7BZ65_PHAVU; Uncharacterized protein
STRINGGLYMA15G03650.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-180ETHYLENE-INSENSITIVE3-like 3